Class a: All alpha proteins [46456] (284 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) consists of single alpha-helix and irregular N-terminal tail |
Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins) |
Protein Methanol dehydrogenase, light chain [48668] (3 species) |
Species Methylophilus methylotrophus, w3a1 [TaxId:17] [48669] (5 PDB entries) |
Domain d4aahb_: 4aah B: [19625] Other proteins in same PDB: d4aaha_, d4aahc_ complexed with ca, pqq |
PDB Entry: 4aah (more details), 2.4 Å
SCOPe Domain Sequences for d4aahb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4aahb_ a.137.2.1 (B:) Methanol dehydrogenase, light chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrianaks sgnfvfdvk
Timeline for d4aahb_: