Lineage for d4aahb_ (4aah B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) (S)
    consists of single alpha-helix and irregular N-terminal tail
    automatically mapped to Pfam PF02315
  5. Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)
  6. Protein Methanol dehydrogenase, light chain [48668] (3 species)
  7. Species Methylophilus methylotrophus, w3a1 [TaxId:17] [48669] (6 PDB entries)
  8. Domain d4aahb_: 4aah B: [19625]
    Other proteins in same PDB: d4aaha_, d4aahc_
    complexed with ca, pqq

Details for d4aahb_

PDB Entry: 4aah (more details), 2.4 Å

PDB Description: methanol dehydrogenase from methylophilus w3a1
PDB Compounds: (B:) methanol dehydrogenase

SCOPe Domain Sequences for d4aahb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aahb_ a.137.2.1 (B:) Methanol dehydrogenase, light chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrianaks
sgnfvfdvk

SCOPe Domain Coordinates for d4aahb_ are not available.

Timeline for d4aahb_:

Domains from other chains:
(mouse over for more information)
d4aaha_, d4aahc_, d4aahd_