Lineage for d4a5ra_ (4a5r A:)
- Root: SCOPe 2.06
Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
contains a cluster of helices and an alpha+beta sandwichSuperfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) Protein automated matches [190161] (23 species)
not a true protein
Species Bacillus licheniformis [TaxId:1402] [188244] (15 PDB entries) 
Domain d4a5ra_: 4a5r A: [193473]
automated match to d2wk0a_
complexed with cit, co2, pge, tbe
Details for d4a5ra_
PDB Entry: 4a5r (more details), 2.1 Å
PDB Description: Crystal structure of class A beta-lactamase from Bacillus licheniformis BS3 with tazobactam
PDB Compounds: (A:) Beta-lactamaseSCOPe Domain Sequences for d4a5ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a5ra_ e.3.1.1 (A:) automated matches {Bacillus licheniformis [TaxId: 1402]}
kddfakleeqfdaklgifaldtgtnrtvtyrpderfafastikaltvgvllqqksiedln
qritytrddlvnynpitekhvdtgmtlkeladaslrysdntaqnlilkqiggpeslkkel
rkigdevtnperfepelnevnpgetqdtstaralatslqafaledklpsekrellidwmk
rnttgdaliragvpegwevadktgagsygtrndiaiiwppkgdpvvlavlssrdkkdaky
ddkliaeatkvvvkaln
SCOPe Domain Coordinates for d4a5ra_:
Click to download the PDB-style file with coordinates for d4a5ra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4a5ra_:
- d4a5ra_ first appeared in SCOPe 2.02
- d4a5ra_ appears in SCOPe 2.05
- d4a5ra_ appears in SCOPe 2.07
- d4a5ra_ appears in the current release, SCOPe 2.08
View in 3D
