Lineage for d3zzba_ (3zzb A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1795288Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)
  6. 1795471Protein automated matches [190384] (12 species)
    not a true protein
  7. 1795497Species Human coxsackievirus [TaxId:12072] [188739] (11 PDB entries)
  8. 1795505Domain d3zzba_: 3zzb A: [194655]
    automated match to d2vb0a_
    complexed with g85

Details for d3zzba_

PDB Entry: 3zzb (more details), 2.1 Å

PDB Description: crystal structure of 3c protease of coxsackievirus b3 complexed with alpha, beta-unsaturated ethyl ester inhibitor 85
PDB Compounds: (A:) 3C proteinase

SCOPe Domain Sequences for d3zzba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zzba_ b.47.1.4 (A:) automated matches {Human coxsackievirus [TaxId: 12072]}
mgpafefavammkrnsstvkteygeftmlgiydrwavlprhakpgptilmndqevgvlda
kelvdkdgtnleltllklnrnekfrdirgflakeevevneavlaintskfpnmyipvgqv
teygflnlggtptkrmlmynfptragqcggvlmstgkvlgihvggnghqgfsaallkhyf
n

SCOPe Domain Coordinates for d3zzba_:

Click to download the PDB-style file with coordinates for d3zzba_.
(The format of our PDB-style files is described here.)

Timeline for d3zzba_: