Lineage for d3zp6e_ (3zp6 E:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.19: Viral protein domain [49817] (1 superfamily)
sandwich; 9 strands in 2 sheets; jelly-roll; form trimersSuperfamily b.19.1: Viral protein domain [49818] (4 families) 
forms homotrimersFamily b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) 
Protein automated matches [190291] (24 species)
not a true proteinSpecies Influenza A virus [TaxId:11320] [187142] (19 PDB entries) 
Domain d3zp6e_: 3zp6 E: [228143]
Other proteins in same PDB: d3zp6f_
automated match to d1rvxa_
complexed with nag; mutant
Details for d3zp6e_
PDB Entry: 3zp6 (more details), 2.6 Å
PDB Description: influenza virus (vn1194) h5 e190d mutant ha with lstc
PDB Compounds: (E:) HaemagglutininSCOPe Domain Sequences for d3zp6e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zp6e_ b.19.1.2 (E:) automated matches {Influenza A virus [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaadqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp
SCOPe Domain Coordinates for d3zp6e_:
Click to download the PDB-style file with coordinates for d3zp6e_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3zp6e_:
- d3zp6e_ first appeared in SCOPe 2.03
- d3zp6e_ appears in SCOPe 2.04
- d3zp6e_ appears in SCOPe 2.06
- d3zp6e_ appears in the current release, SCOPe 2.08
View in 3D
