Lineage for d3zn2a_ (3zn2 A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.0: automated matches [191313] (1 protein)
not a true familyProtein automated matches [190069] (239 species)
not a true protein
Species Agrobacterium tumefaciens [TaxId:358] [193697] (5 PDB entries) 
Domain d3zn2a_: 3zn2 A: [237529]
automated match to d3osua_
complexed with act, k, na, pg5
Details for d3zn2a_
PDB Entry: 3zn2 (more details), 1.8 Å
PDB Description: protein engineering of halohydrin dehalogenase
PDB Compounds: (A:) halohydrin dehalogenaseSCOPe Domain Sequences for d3zn2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zn2a_ c.2.1.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 358]}
staivtnvkhfggmgsalrlseaghtvachdesfkqkdeleafaetypqlkpmseqepae
lieavtsaygqvdvlvsndifapefqpidkyavedyrgavealqirpfalvnavasqmkk
rksghiifitsaapfgpwkelstytsaragastlanalskelgeynipvfaigpnylhse
dspyfyptepwktnpehvahvkkvtalqrlgtqkelgelvaflasgscdyltgqvfwlag
gfpmierfpgmpe
SCOPe Domain Coordinates for d3zn2a_:
Click to download the PDB-style file with coordinates for d3zn2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3zn2a_:
- d3zn2a_ first appeared in SCOPe 2.03
- d3zn2a_ appears in SCOPe 2.05
- d3zn2a_ appears in SCOPe 2.07
- d3zn2a_ appears in the current release, SCOPe 2.08
View in 3D
