Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (83 species) not a true protein |
Species Streptococcus pyogenes [TaxId:286636] [236665] (3 PDB entries) |
Domain d3zlfb1: 3zlf B:0-139 [236666] Other proteins in same PDB: d3zlfa2, d3zlfb2, d3zlfc2, d3zlfd2 automated match to d1p43a2 complexed with po4; mutant |
PDB Entry: 3zlf (more details), 2.15 Å
SCOPe Domain Sequences for d3zlfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zlfb1 d.54.1.0 (B:0-139) automated matches {Streptococcus pyogenes [TaxId: 286636]} hmsiitdvyarevldsrgnptlevevytesgafgrgmvpsgastgeheavelrdgdksry lglgtqkavdnvnniiakaiigydvrdqqaidramialdgtpnkgklganailgvsiava raaadylevplytylggfnt
Timeline for d3zlfb1: