Lineage for d3ziza_ (3ziz A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2093694Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2094316Protein automated matches [190057] (26 species)
    not a true protein
  7. 2094395Species Podospora anserina [TaxId:5145] [256160] (1 PDB entry)
  8. 2094396Domain d3ziza_: 3ziz A: [250791]
    automated match to d1qnra_
    complexed with gol, trs

Details for d3ziza_

PDB Entry: 3ziz (more details), 1.4 Å

PDB Description: Crystal structure of Podospora anserina GH5 beta-(1,4)-mannanase
PDB Compounds: (A:) gh5 endo-beta-1,4-mannanase

SCOPe Domain Sequences for d3ziza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ziza_ c.1.8.3 (A:) automated matches {Podospora anserina [TaxId: 5145]}
sakvsgtrfvidgktgyfagtnsywigfltnnrdvdttldhiassglkilrvwgfndvnn
qpsgntvwfqrlassgsqintgpnglqrldylvrsaetrgikliialvnywddfggmkay
vnafggtkeswytnaraqeqykryiqavvsryvnspaifawelaneprckgcntnvifnw
atqisdyirsldkdhlitlgdegfglpgqttypyqygegtdfvknlqiknldfgtfhmyp
ghwgvptsfgpgwikdhaaacraagkpclleeygyesdrcnvqkgwqqasrelsrdgmsg
dlfwqwgdqlstgqthndgftiyygsslatclvtdhvrainalpa

SCOPe Domain Coordinates for d3ziza_:

Click to download the PDB-style file with coordinates for d3ziza_.
(The format of our PDB-style files is described here.)

Timeline for d3ziza_: