Lineage for d3zija_ (3zij A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.0: automated matches [191312] (1 protein)
not a true familyProtein automated matches [190056] (195 species)
not a true protein
Species Bacillus cereus [TaxId:1396] [193273] (2 PDB entries) 
Domain d3zija_: 3zij A: [193274]
automated match to d1r7ha_
Details for d3zija_
PDB Entry: 3zij (more details), 1.4 Å
PDB Description: Crystal structure of the thioredoxin-like protein BC3987
PDB Compounds: (A:) thioredoxinSCOPe Domain Sequences for d3zija_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zija_ c.47.1.0 (A:) automated matches {Bacillus cereus [TaxId: 1396]}
mkkievytqpdcppcvivkeflkhnnvayeefdvkkdaaarnrllydydsystptvvidg
evvagfqieklqqlln
SCOPe Domain Coordinates for d3zija_:
Click to download the PDB-style file with coordinates for d3zija_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3zija_:
- d3zija_ first appeared in SCOPe 2.02
- d3zija_ appears in SCOPe 2.07
View in 3D
