Lineage for d3ze9a_ (3ze9 A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222239Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2222240Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2222241Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 protein domains)
  6. 2222271Protein automated matches [190110] (7 species)
    not a true protein
  7. 2222348Species Desulfovibrio vulgaris [TaxId:882] [197352] (11 PDB entries)
  8. 2222349Domain d3ze9a_: 3ze9 A: [197359]
    Other proteins in same PDB: d3ze9b_
    automated match to d1cc1s_
    complexed with cl, fco, fe2, fsx, ni, sf4

Details for d3ze9a_

PDB Entry: 3ze9 (more details), 1.33 Å

PDB Description: 3D structure of the NiFeSe hydrogenase from D. vulgaris Hildenborough in the oxidized as-isolated state at 1.33 Angstroms
PDB Compounds: (A:) periplasmic [nifese] hydrogenase, small subunit

SCOPe Domain Sequences for d3ze9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ze9a_ e.19.1.1 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
gerppvfwlqgqgctgcsvtllnsvhpsiadvllkvislefhptvmawegehaiehmrkv
aekfkgkfflviegsvpveadgkyciigeanhheismvdalkefgpnaaavlavgtcaay
ggipaaegsetgatavskflgdngiktpvvnipgcpphpdwivgtvvlaldaikkngleg
glaevvkvldsdgrptpffgrnihencpyldkydegvmsatftdkvgcrydlgckgpmtm
adcferkwnggvnwcvqnavcigcvepdfpdgkspfyqa

SCOPe Domain Coordinates for d3ze9a_:

Click to download the PDB-style file with coordinates for d3ze9a_.
(The format of our PDB-style files is described here.)

Timeline for d3ze9a_: