Lineage for d3wyha_ (3wyh A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) Fold d.2: Lysozyme-like [53954] (1 superfamily)
common alpha+beta motif for the active site regionSuperfamily d.2.1: Lysozyme-like [53955] (12 families) 
Family d.2.1.5: G-type lysozyme [53987] (2 proteins) Protein automated matches [191098] (3 species)
not a true protein
Species Struthio camelus [TaxId:8801] [260476] (1 PDB entry) 
Domain d3wyha_: 3wyh A: [260477]
automated match to d153la_
complexed with p6g, tam; mutant
Details for d3wyha_
PDB Entry: 3wyh (more details), 1.77 Å
PDB Description: Structure of disulfide bond deletion mutant of ostrich egg white lysozyme
PDB Compounds: (A:) Lysozyme gSCOPe Domain Sequences for d3wyha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wyha_ d.2.1.5 (A:) automated matches {Struthio camelus [TaxId: 8801]}
rtgsygdvnrvdttgassksakpeklnysgvaasrkiaerdlqsmdrykalikkvgqkls
vdpaviagiisreshagkalrngwgdngngfglmqvdrrshkpvgewngerhlmqgteil
ismikaiqkkfprwtkeqqlkggisaynagpgnvrsyermdigtthddyandvvaraqyy
kqhgy
SCOPe Domain Coordinates for d3wyha_:
Click to download the PDB-style file with coordinates for d3wyha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3wyha_:
- d3wyha_ first appeared in SCOPe 2.04
- d3wyha_ appears in SCOPe 2.06
- d3wyha_ appears in the current release, SCOPe 2.08
View in 3D
