Lineage for d3wu1b_ (3wu1 B:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) 
contains a small beta-sheet (wing)
Family a.4.5.21: ets domain [46859] (9 proteins) 
Protein automated matches [191121] (2 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [193283] (15 PDB entries) 
Domain d3wu1b_: 3wu1 B: [259151]
Other proteins in same PDB: d3wu1a_
automated match to d1k79a_
protein/DNA complex
Details for d3wu1b_
PDB Entry: 3wu1 (more details), 2.4 Å
PDB Description: crystal structure of the ets1-runx1-dna ternary complex
PDB Compounds: (B:) Protein C-ets-1SCOPe Domain Sequences for d3wu1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wu1b_ a.4.5.21 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrknkpkmnyeklsrg
lryyydkniihktagkryvyrfvcdlqsllgytpeelhamldvkp
SCOPe Domain Coordinates for d3wu1b_:
Click to download the PDB-style file with coordinates for d3wu1b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3wu1b_:
- d3wu1b_ first appeared in SCOPe 2.04
- d3wu1b_ appears in SCOPe 2.07
View in 3D
