Lineage for d3wsob1 (3wso B:1-69)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552337Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2552338Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2552678Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2552679Protein automated matches [190710] (5 species)
    not a true protein
  7. 2552682Species Human (Homo sapiens) [TaxId:9606] [187857] (53 PDB entries)
  8. 2552787Domain d3wsob1: 3wso B:1-69 [270794]
    Other proteins in same PDB: d3wsob2
    automated match to d4i6jc1

Details for d3wsob1

PDB Entry: 3wso (more details), 2.6 Å

PDB Description: crystal structure of the skp1-fbg3 complex
PDB Compounds: (B:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d3wsob1:

Sequence, based on SEQRES records: (download)

>d3wsob1 d.42.1.0 (B:1-69) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpsiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviq
wcthhkddp

Sequence, based on observed residues (ATOM records): (download)

>d3wsob1 d.42.1.0 (B:1-69) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpsiklqssdgeifevdveiakqsvtiktmleddpvplpnvnaailkkviqwcthhkddp

SCOPe Domain Coordinates for d3wsob1:

Click to download the PDB-style file with coordinates for d3wsob1.
(The format of our PDB-style files is described here.)

Timeline for d3wsob1: