Lineage for d3wsob1 (3wso B:1-69)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.42: POZ domain [54694] (1 superfamily)
core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143Superfamily d.42.1: POZ domain [54695] (3 families) 
Family d.42.1.0: automated matches [191460] (1 protein)
not a true familyProtein automated matches [190710] (3 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187857] (39 PDB entries) 
Domain d3wsob1: 3wso B:1-69 [270794]
Other proteins in same PDB: d3wsob2
automated match to d4i6jc1
Details for d3wsob1
PDB Entry: 3wso (more details), 2.6 Å
PDB Description: crystal structure of the skp1-fbg3 complex
PDB Compounds: (B:) S-phase kinase-associated protein 1SCOPe Domain Sequences for d3wsob1:
Sequence, based on SEQRES records: (download)
>d3wsob1 d.42.1.0 (B:1-69) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpsiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviq
wcthhkddp
Sequence, based on observed residues (ATOM records): (download)
>d3wsob1 d.42.1.0 (B:1-69) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpsiklqssdgeifevdveiakqsvtiktmleddpvplpnvnaailkkviqwcthhkddp
SCOPe Domain Coordinates for d3wsob1:
Click to download the PDB-style file with coordinates for d3wsob1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3wsob1:
- d3wsob1 first appeared in SCOPe 2.05
- d3wsob1 appears in SCOPe 2.07
- d3wsob1 appears in the current release, SCOPe 2.08
View in 3D
