Lineage for d3wptb_ (3wpt B:)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.1: ARM repeat [48371] (26 families) 
Family a.118.1.1: Armadillo repeat [48372] (7 proteins)
this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain
Protein automated matches [190070] (4 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187211] (12 PDB entries) 
Domain d3wptb_: 3wpt B: [268047]
automated match to d3knda_
complexed with peg
Details for d3wptb_
PDB Entry: 3wpt (more details), 2.63 Å
PDB Description: Crystal structure of closed dimer of human importin-alpha1 (Rch1)
PDB Compounds: (B:) Importin subunit alpha-1SCOPe Domain Sequences for d3wptb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wptb_ a.118.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nwsvddivkginssnvenqlqatqaarkllsrekqppidniiraglipkfvsflgrtdcs
piqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniagdgs
vfrdlvikygavdpllallavpdmsslacgylrnltwtlsnlcrnknpappidaveqilp
tlvrllhhddpevladtcwaisyltdgpnerigmvvktgvvpqlvkllgaselpivtpal
raignivtgtdeqtqvvidagalavfpslltnpktniqkeatwtmsnitagrqdqiqqvv
nhglvpflvsvlskadfktqkeavwavtnytsggtveqivylvhcgiieplmnlltakdt
kiilvildaisnifqaaeklgeteklsimieecggldkiealqnhenesvykaslsliek
yfs
SCOPe Domain Coordinates for d3wptb_:
Click to download the PDB-style file with coordinates for d3wptb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3wptb_:
- d3wptb_ first appeared in SCOPe 2.05
- d3wptb_ appears in SCOPe 2.07
- d3wptb_ appears in the current release, SCOPe 2.08
View in 3D
