Lineage for d3wlwd_ (3wlw D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2759250Domain d3wlwd_: 3wlw D: [413547]
    automated match to d6shgl_
    complexed with nag

Details for d3wlwd_

PDB Entry: 3wlw (more details), 3.09 Å

PDB Description: molecular architecture of the erbb2 extracellular domain homodimer
PDB Compounds: (D:) Antibody L Chain

SCOPe Domain Sequences for d3wlwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wlwd_ b.1.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsaltqpasvsgspgqsitisctgtssdvggynyvswyqqhpgkapklmiydvskrpsgv
snrfsgsksgntasltisglqaedeadyycssytssstlvfgggtkltvlgtvaapsvfi
fppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslss
tltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d3wlwd_:

Click to download the PDB-style file with coordinates for d3wlwd_.
(The format of our PDB-style files is described here.)

Timeline for d3wlwd_:

  • d3wlwd_ is new in SCOPe 2.08-stable