Lineage for d3wkmm2 (3wkm M:112-214)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1297218Species Mus musculus [TaxId:10090] [227304] (35 PDB entries)
  8. 1297242Domain d3wkmm2: 3wkm M:112-214 [229993]
    automated match to d1g9ml2

Details for d3wkmm2

PDB Entry: 3wkm (more details), 2.2 Å

PDB Description: The periplasmic PDZ tandem fragment of the RseP homologue from Aquifex aeolicus in complex with the Fab fragment
PDB Compounds: (M:) mouse igg1-kappa fab (light chain)

SCOPe Domain Sequences for d3wkmm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wkmm2 b.1.1.0 (M:112-214) automated matches {Mus musculus [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfn

SCOPe Domain Coordinates for d3wkmm2:

Click to download the PDB-style file with coordinates for d3wkmm2.
(The format of our PDB-style files is described here.)

Timeline for d3wkmm2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wkmm1