Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Mus musculus [TaxId:10090] [227304] (35 PDB entries) |
Domain d3wkmm2: 3wkm M:112-214 [229993] automated match to d1g9ml2 |
PDB Entry: 3wkm (more details), 2.2 Å
SCOPe Domain Sequences for d3wkmm2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wkmm2 b.1.1.0 (M:112-214) automated matches {Mus musculus [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfn
Timeline for d3wkmm2: