Lineage for d3wjab1 (3wja B:18-279)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) 
Family c.58.1.0: automated matches [227157] (1 protein)
not a true familyProtein automated matches [226864] (40 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [225016] (9 PDB entries) 
Domain d3wjab1: 3wja B:18-279 [259044]
Other proteins in same PDB: d3wjaa2, d3wjab2
automated match to d1gq2a2
Details for d3wjab1
PDB Entry: 3wja (more details), 2.55 Å
PDB Description: the crystal structure of human cytosolic nadp(+)-dependent malic enzyme in apo form
PDB Compounds: (B:) NADP-dependent malic enzymeSCOPe Domain Sequences for d3wjab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wjab1 c.58.1.0 (B:18-279) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrhthqrgylltrnphlnkdlaftleerqqlnihgllppsfnsqeiqvlrvvknfehlns
dfdrylllmdlqdrneklfyrvltsdiekfmpivytptvglacqqyslvfrkprglfiti
hdrghiasvlnawpedvikaivvtdgerilglgdlgcngmgipvgklalytacggmnpqe
clpvildvgteneellkdplyiglrqrrvrgseyddfldefmeavsskygmncliqfedf
anvnafrllnkyrnqyctfndd
SCOPe Domain Coordinates for d3wjab1:
Click to download the PDB-style file with coordinates for d3wjab1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3wjab1:
- d3wjab1 first appeared in SCOPe 2.04
- d3wjab1 appears in SCOPe 2.07
View in 3D
