Lineage for d3wi7b_ (3wi7 B:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the restSuperfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) 
many members have left-handed crossover connection between strand 8 and additional strand 9
Family c.69.1.0: automated matches [191404] (1 protein)
not a true familyProtein automated matches [190543] (91 species)
not a true protein
Species Agrobacterium tumefaciens [TaxId:176299] [188961] (3 PDB entries) 
Domain d3wi7b_: 3wi7 B: [258606]
automated match to d2qvba_
complexed with gol, nhe
Details for d3wi7b_
PDB Entry: 3wi7 (more details), 1.7 Å
PDB Description: crystal structure of the novel haloalkane dehalogenase data from agrobacterium tumefaciens c58
PDB Compounds: (B:) haloalkane dehalogenaseSCOPe Domain Sequences for d3wi7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wi7b_ c.69.1.0 (B:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
phsafgdgakaydvpafglqihtvehgsgapivflhgnptssylwrhifrrlhghgrlla
vdligygqsskpdieytlenqqryvdawfdaldlrnvtlvlqdygaafglnwasrnpdrv
ravaffepvlrnidsvdlspefvtrraklrqpgegeifvqqenrfltelfpwffltplap
edlrqyqtpfptphsrkailagprnlpvdgepastvafleqavnwlntsdtpkllltfkp
gflltdailkwsqvtirnleieaagagihfvqeeqpetiarlldawltria
SCOPe Domain Coordinates for d3wi7b_:
Click to download the PDB-style file with coordinates for d3wi7b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3wi7b_:
- d3wi7b_ first appeared in SCOPe 2.04
- d3wi7b_ appears in SCOPe 2.05
- d3wi7b_ appears in SCOPe 2.07
- d3wi7b_ appears in the current release, SCOPe 2.08
View in 3D
