SCOPe 2.05: Domain d3wd8d1: 3wd8 D:-1-235

Lineage for d3wd8d1 (3wd8 D:-1-235)

Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.95: Thiolase-like [53900] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

Superfamily c.95.1: Thiolase-like [53901] (3 families)
Family c.95.1.0: automated matches [196908] (1 protein)
not a true family
Protein automated matches [196909] (52 species)
not a true protein
Species Citrus microcarpa [TaxId:164113] [227815] (2 PDB entries)
Domain d3wd8d1: 3wd8 D:-1-235 [227816]
automated match to d1cmla1
complexed with gol

Details for d3wd8d1

PDB Entry: 3wd8 (more details), 2.46 Å

PDB Description: TypeIII polyketide synthases

PDB Compounds: (D:) Type III polyketide synthase quinolone synthase

SCOPe Domain Sequences for d3wd8d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wd8d1 c.95.1.0 (D:-1-235) automated matches {Citrus microcarpa [TaxId: 164113]}
gsmakvknflnakrskgpasilaigtanpptcfnqsdypdfyfrvtdcehktelkdkfkr
icdrsavkkrylhvteevlkenpsmrsynapsldarqallieqvpklgkeaaakaikewg
qplskithlvfsamagvdipgadlrlmnllglepsvkrlmiysqgcfiggaaircakdfa
ennagarvlvvfsdimnmyfhepqeahldilvgqavfgdgaaavivgadpevsierp

SCOPe Domain Coordinates for d3wd8d1:

Click to download the PDB-style file with coordinates for d3wd8d1.
(The format of our PDB-style files is described here.)

Timeline for d3wd8d1: