Lineage for d3wd7a2 (3wd7 A:236-389)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2164457Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2164458Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2165221Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2165222Protein automated matches [196909] (60 species)
    not a true protein
  7. 2165332Species Citrus microcarpa [TaxId:164113] [227815] (2 PDB entries)
  8. 2165334Domain d3wd7a2: 3wd7 A:236-389 [233951]
    Other proteins in same PDB: d3wd7a3, d3wd7b3
    automated match to d3wd8d2
    complexed with coa, ni, so4

Details for d3wd7a2

PDB Entry: 3wd7 (more details), 2.35 Å

PDB Description: Type III polyketide synthase
PDB Compounds: (A:) Type III polyketide synthases acridone synthase

SCOPe Domain Sequences for d3wd7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wd7a2 c.95.1.0 (A:236-389) automated matches {Citrus microcarpa [TaxId: 164113]}
lyhivsasqtllpdsdgaieghireagltvhlkkdvpeffsaniekslvdaftpigisdw
nsifwiahpggpaildqveaklglkkdklrasrhvmseygnmssacvlfildemrnkcle
egkattgegldwgvlfgfgpgltvetvvlhslpi

SCOPe Domain Coordinates for d3wd7a2:

Click to download the PDB-style file with coordinates for d3wd7a2.
(The format of our PDB-style files is described here.)

Timeline for d3wd7a2: