SCOPe 2.08: Domain d3wd6b2: 3wd6 B:109-250

Lineage for d3wd6b2 (3wd6 B:109-250)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
this domains follows the thioredoxin-like N-terminal domain
Family a.45.1.0: automated matches [227130] (1 protein)
not a true family
Protein automated matches [226831] (73 species)
not a true protein
Species Silkworm (Bombyx mori) [TaxId:7091] [226184] (9 PDB entries)
Domain d3wd6b2: 3wd6 B:109-250 [258585]
Other proteins in same PDB: d3wd6a1, d3wd6b1, d3wd6c1, d3wd6d1
automated match to d3q18a2
complexed with edo, gsh, iod, k, peg

Details for d3wd6b2

PDB Entry: 3wd6 (more details), 2.5 Å

PDB Description: Crystal structure of Bombyx mori omega-class glutathione transferase in complex with GSH

PDB Compounds: (B:) Omega-class glutathione S-transferase

SCOPe Domain Sequences for d3wd6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wd6b2 a.45.1.0 (B:109-250) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
lpqdplkkaldkiiveasapiqslfikilkfsdtvneehvaayhkaldfiqeqlknrgtv
fldgsepgyadymiwpwferlrafahdervrlepskysllleyidnmlkdsavsqylipl
eilakfheaytkkerpnyelln

SCOPe Domain Coordinates for d3wd6b2:

Click to download the PDB-style file with coordinates for d3wd6b2.
(The format of our PDB-style files is described here.)

Timeline for d3wd6b2: