Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein Muscle fatty acid binding protein (m-fabp) [50848] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50849] (22 PDB entries) |
Domain d3wbgb_: 3wbg B: [228742] automated match to d1lida_ complexed with 2an |
PDB Entry: 3wbg (more details), 2.15 Å
SCOPe Domain Sequences for d3wbgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wbgb_ b.60.1.2 (B:) Muscle fatty acid binding protein (m-fabp) {Human (Homo sapiens) [TaxId: 9606]} mvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfkn teisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlth gtavctrtyeke
Timeline for d3wbgb_: