Lineage for d3w6ua2 (3w6u A:162-283)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetrySuperfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) 
N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
Family a.100.1.0: automated matches [227147] (1 protein)
not a true familyProtein automated matches [226851] (35 species)
not a true protein
Species Pyrobaculum calidifontis [TaxId:410359] [236095] (3 PDB entries) 
Domain d3w6ua2: 3w6u A:162-283 [236096]
Other proteins in same PDB: d3w6ua1
automated match to d1vpda1
complexed with nap
Details for d3w6ua2
PDB Entry: 3w6u (more details), 2 Å
PDB Description: crystal structure of nadp bound l-serine 3-dehydrogenase from hyperthermophilic archaeon pyrobaculum calidifontis
PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, NAD-binding proteinSCOPe Domain Sequences for d3w6ua2:
Sequence, based on SEQRES records: (download)
>d3w6ua2 a.100.1.0 (A:162-283) automated matches {Pyrobaculum calidifontis [TaxId: 410359]}
pvgygqamklvnqvvvalntvamveglklakalgldmdkvaevltrgaarsgaielylpk
llkgdlspgfkaehlkkdlgyvleearkrgvklpgaelayelyrkmvedgagslgihalg
fy
Sequence, based on observed residues (ATOM records): (download)
>d3w6ua2 a.100.1.0 (A:162-283) automated matches {Pyrobaculum calidifontis [TaxId: 410359]}
pvgygqamklvnqvvvalntvamveglklakalgldmdkvaevltrsgaielylpkllkg
dlspgfkaehlkkdlgyvleearkrgvklpgaelayelyrkmvedgagslgihalgfy
SCOPe Domain Coordinates for d3w6ua2:
Click to download the PDB-style file with coordinates for d3w6ua2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3w6ua2:
- d3w6ua2 first appeared in SCOPe 2.03
- d3w6ua2 appears in SCOPe 2.05
- d3w6ua2 appears in SCOPe 2.07
- d3w6ua2 appears in the current release, SCOPe 2.08
View in 3D
