Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (132 species) not a true protein |
Species Thermoanaerobacterium saccharolyticum [TaxId:1094508] [196751] (6 PDB entries) |
Domain d3w28a_: 3w28 A: [196753] automated match to d3ms8a_ mutant |
PDB Entry: 3w28 (more details), 1.39 Å
SCOPe Domain Sequences for d3w28a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w28a_ c.1.8.0 (A:) automated matches {Thermoanaerobacterium saccharolyticum [TaxId: 1094508]} tiqndipdlysvfkdyfpigvavdpsrlndadphaqltakhfnmlvaenamkpeslqpte gnftfdnadkivdyaiahnmkmrghtllwhnqvpdwffqdpsdpskpasrdlllqrlrth ittvldhfktkygsqnpiigwdvvnevlddngnlrnskwlqiigpdyiekafeyaheadp smklfindynienngvktqamydlvkklknegvpingigmqmhisinsnidnikasiekl aslgveiqvtaldmnmngdvsndallkqarlykqlfdlfkaekqyitavvfwgvsddvsw lskpnapllfdsklqakpaywaiv
Timeline for d3w28a_: