Lineage for d3w1ya_ (3w1y A:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) 
Family d.15.1.0: automated matches [191343] (1 protein)
not a true familyProtein automated matches [190233] (10 species)
not a true protein
Species Trypanosoma brucei [TaxId:999953] [229344] (2 PDB entries) 
Domain d3w1ya_: 3w1y A: [229345]
automated match to d3vvwb_
Details for d3w1ya_
PDB Entry: 3w1y (more details), 2.3 Å
PDB Description: Crystal structure of T brucei ATG8.2 in complex with E coli S10
PDB Compounds: (A:) Microtubule-associated protein 1A/1B, light chain 3SCOPe Domain Sequences for d3w1ya_:
Sequence, based on SEQRES records: (download)
>d3w1ya_ d.15.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 999953]}
hyryqytrsfaeraketesarlrypkhipilceptsaasastprdvrlfstrqqvqreld
cnkfllpetatvmefmmalrqrllleegqavfvfignelppnsaclgdiyarakdpdgfl
yvsygvent
Sequence, based on observed residues (ATOM records): (download)
>d3w1ya_ d.15.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 999953]}
hyryqytrsfaeraketesarlrypkhipilceptsvrlfstrqqvqreldcnkfllpet
atvmefmmalrqrllleegqavfvfignelppnsaclgdiyarakdpdgflyvsygvent
SCOPe Domain Coordinates for d3w1ya_:
Click to download the PDB-style file with coordinates for d3w1ya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3w1ya_:
- d3w1ya_ first appeared in SCOPe 2.03
- d3w1ya_ appears in SCOPe 2.05
- d3w1ya_ appears in the current release, SCOPe 2.08
View in 3D
