Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (13 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187331] (22 PDB entries) |
Domain d3vyka_: 3vyk A: [228130] automated match to d1umrc_ complexed with ca, edo, so4 |
PDB Entry: 3vyk (more details), 1.5 Å
SCOPe Domain Sequences for d3vyka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vyka_ d.169.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} scpkdwkpfvshcyfilndskaswneseekcshmgahlvvihsqaeqdfitsnlntsagy figlldagqrqwrwidqtpynksatfwhkgepnqdwercviinhkttgwgwndipckdeh nsvcqvkk
Timeline for d3vyka_: