SCOPe 2.03: Domain d3vxqe1: 3vxq E:2-114

Lineage for d3vxqe1 (3vxq E:2-114)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (23 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)
Domain d3vxqe1: 3vxq E:2-114 [228564]
Other proteins in same PDB: d3vxqa2, d3vxqd2
automated match to d3q5ya1

Details for d3vxqe1

PDB Description: H27-14 TCR specific for HLA-A24-Nef134-10

PDB Compounds: (E:) H27-14 TCR beta chain

SCOPe Domain Sequences for d3vxqe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vxqe1 b.1.1.0 (E:2-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tgvsqnprhkitkrgqnvtfrcdpisehnrlywyrqtlgqgpefltyfqneaqleksrll
sdrfsaerpkgsfstleiqrteqgdsamylcassswdtgelffgegsrltvle

SCOPe Domain Coordinates for d3vxqe1:

Click to download the PDB-style file with coordinates for d3vxqe1.
(The format of our PDB-style files is described here.)

Timeline for d3vxqe1: