Lineage for d3vtva_ (3vtv A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2178376Family d.15.1.3: GABARAP-like [54253] (4 proteins)
    intracellular membrane trafficking and fusion proteins
    automatically mapped to Pfam PF02991
  6. 2178398Protein automated matches [190358] (5 species)
    not a true protein
  7. 2178411Species Human (Homo sapiens) [TaxId:9606] [187279] (26 PDB entries)
  8. 2178419Domain d3vtva_: 3vtv A: [218103]
    automated match to d2zjdc_
    complexed with so4

Details for d3vtva_

PDB Entry: 3vtv (more details), 1.7 Å

PDB Description: crystal structure of optineurin lir-fused human lc3b_2-119
PDB Compounds: (A:) Optineurin, microtubule-associated proteins 1A/1B light chain 3B

SCOPe Domain Sequences for d3vtva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vtva_ d.15.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efveiggpsektfkqrrtfeqrvedvrlireqhptkipviierykgekqlpvldktkflv
pdhvnmselikiirrrlqlnanqaffllvnghsmvsvstpisevyesekdedgflymvya
sqetf

SCOPe Domain Coordinates for d3vtva_:

Click to download the PDB-style file with coordinates for d3vtva_.
(The format of our PDB-style files is described here.)

Timeline for d3vtva_: