Lineage for d3vpnb_ (3vpn B:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.25: Ferritin-like [47239] (6 superfamilies)
core: 4 helices; bundle, closed, left-handed twist; 1 crossover connectionSuperfamily a.25.1: Ferritin-like [47240] (10 families) 
contains bimetal-ion centre in the middle of the bundle
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) 
Protein automated matches [190435] (9 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [193902] (6 PDB entries) 
Domain d3vpnb_: 3vpn B: [193905]
automated match to d2uw2a1
complexed with fe, mg; mutant
Details for d3vpnb_
PDB Entry: 3vpn (more details), 2.25 Å
PDB Description: crystal structure of human ribonucleotide reductase subunit m2 (hrrm2) mutant
PDB Compounds: (B:) Ribonucleoside-diphosphate reductase subunit M2SCOPe Domain Sequences for d3vpnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vpnb_ a.25.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgvedepllrenprrfvifpieyhdiwqmykkaeasfwtaedvdlskdiqhweslkpeer
yfishvlaffaasdgivnenlverfsqevqitearcfygfqiamenihsemysllidtyi
kdpkereflfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasif
wlkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpseervreiiinavrieqefl
tealpvkligmnctlmkqyiefvadrlmlelgfskvfrvenpfdfm
SCOPe Domain Coordinates for d3vpnb_:
Click to download the PDB-style file with coordinates for d3vpnb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3vpnb_:
- d3vpnb_ first appeared in SCOPe 2.02
- d3vpnb_ appears in SCOPe 2.04
- d3vpnb_ is called d3vpnb1 in SCOPe 2.06
- d3vpnb_ appears in the current release, SCOPe 2.08, called d3vpnb1
View in 3D
