Lineage for d3vpnb_ (3vpn B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1729174Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 1729468Protein automated matches [190435] (9 species)
    not a true protein
  7. 1729537Species Human (Homo sapiens) [TaxId:9606] [193902] (6 PDB entries)
  8. 1729545Domain d3vpnb_: 3vpn B: [193905]
    automated match to d2uw2a1
    complexed with fe, mg; mutant

Details for d3vpnb_

PDB Entry: 3vpn (more details), 2.25 Å

PDB Description: crystal structure of human ribonucleotide reductase subunit m2 (hrrm2) mutant
PDB Compounds: (B:) Ribonucleoside-diphosphate reductase subunit M2

SCOPe Domain Sequences for d3vpnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vpnb_ a.25.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgvedepllrenprrfvifpieyhdiwqmykkaeasfwtaedvdlskdiqhweslkpeer
yfishvlaffaasdgivnenlverfsqevqitearcfygfqiamenihsemysllidtyi
kdpkereflfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasif
wlkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpseervreiiinavrieqefl
tealpvkligmnctlmkqyiefvadrlmlelgfskvfrvenpfdfm

SCOPe Domain Coordinates for d3vpnb_:

Click to download the PDB-style file with coordinates for d3vpnb_.
(The format of our PDB-style files is described here.)

Timeline for d3vpnb_: