Lineage for d3vdga1 (3vdg A:0-138)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
beta(3)-alpha(3); meander and up-and-down bundleSuperfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) 
Family d.54.1.0: automated matches [227195] (1 protein)
not a true familyProtein automated matches [226922] (83 species)
not a true protein
Species Mycobacterium smegmatis [TaxId:246196] [225617] (5 PDB entries) 
Domain d3vdga1: 3vdg A:0-138 [233846]
Other proteins in same PDB: d3vdga2
automated match to d4it1d1
complexed with act, cl, fmt, na
Details for d3vdga1
PDB Entry: 3vdg (more details), 1.9 Å
PDB Description: crystal structure of enolase msmeg_6132 (target efi-502282) from mycobacterium smegmatis str. mc2 155 complexed with formate and acetate
PDB Compounds: (A:) Probable glucarate dehydrataseSCOPe Domain Sequences for d3vdga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vdga1 d.54.1.0 (A:0-138) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
smahnriritgarvtpvafadppllntvgvhqpyalraviqldtdagltglgetyadtvh
lerlqaaahaivgrsvfstnviralisdalggdrtgdgsglagmitsasvvdrvfspfev
acldvqgqvtgrpvsdllg
SCOPe Domain Coordinates for d3vdga1:
Click to download the PDB-style file with coordinates for d3vdga1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3vdga1:
- d3vdga1 first appeared in SCOPe 2.03
- d3vdga1 appears in SCOPe 2.04
- d3vdga1 appears in SCOPe 2.06
- d3vdga1 appears in the current release, SCOPe 2.08
View in 3D
