Lineage for d3vc6a1 (3vc6 A:1-133)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191243Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2191244Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2191540Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2191541Protein automated matches [226922] (88 species)
    not a true protein
  7. 2192224Species Thermobispora bispora [TaxId:469371] [233840] (3 PDB entries)
  8. 2192226Domain d3vc6a1: 3vc6 A:1-133 [233842]
    Other proteins in same PDB: d3vc6a2, d3vc6a3
    automated match to d4it1d1
    complexed with fmt, mg

Details for d3vc6a1

PDB Entry: 3vc6 (more details), 1.64 Å

PDB Description: crystal structure of enolase tbis_1083(target efi-502310) from thermobispora bispora dsm 43833 complexed with magnesium and formate
PDB Compounds: (A:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3vc6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vc6a1 d.54.1.0 (A:1-133) automated matches {Thermobispora bispora [TaxId: 469371]}
mlirevrvtpvafrdppllnaagvhqpwalrtivevvtdegitglgetygdlahleqvra
aaarlpgldvyalhriyrrvadvvganivtdmhgltgsssrvktvdrvfaafevacldiq
gkaagrpvadllg

SCOPe Domain Coordinates for d3vc6a1:

Click to download the PDB-style file with coordinates for d3vc6a1.
(The format of our PDB-style files is described here.)

Timeline for d3vc6a1: