Lineage for d3vc6a1 (3vc6 A:0-133)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
beta(3)-alpha(3); meander and up-and-down bundleSuperfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) 
Family d.54.1.0: automated matches [227195] (1 protein)
not a true familyProtein automated matches [226922] (67 species)
not a true protein
Species Thermobispora bispora [TaxId:469371] [233840] (3 PDB entries) 
Domain d3vc6a1: 3vc6 A:0-133 [233842]
Other proteins in same PDB: d3vc6a2
automated match to d4it1d1
complexed with fmt, mg
Details for d3vc6a1
PDB Entry: 3vc6 (more details), 1.64 Å
PDB Description: crystal structure of enolase tbis_1083(target efi-502310) from thermobispora bispora dsm 43833 complexed with magnesium and formate
PDB Compounds: (A:) Mandelate racemase/muconate lactonizing proteinSCOPe Domain Sequences for d3vc6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vc6a1 d.54.1.0 (A:0-133) automated matches {Thermobispora bispora [TaxId: 469371]}
smlirevrvtpvafrdppllnaagvhqpwalrtivevvtdegitglgetygdlahleqvr
aaaarlpgldvyalhriyrrvadvvganivtdmhgltgsssrvktvdrvfaafevacldi
qgkaagrpvadllg
SCOPe Domain Coordinates for d3vc6a1:
Click to download the PDB-style file with coordinates for d3vc6a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3vc6a1:
- d3vc6a1 first appeared in SCOPe 2.03
- d3vc6a1 appears in SCOPe 2.05
- d3vc6a1 appears in the current release, SCOPe 2.08
View in 3D
