Lineage for d3v64b_ (3v64 B:)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) 
Family b.29.1.4: Laminin G-like module [49944] (7 proteins) 
Protein automated matches [190380] (2 species)
not a true protein
Species Norway rat (Rattus norvegicus) [TaxId:10116] [189379] (3 PDB entries) 
Domain d3v64b_: 3v64 B: [195489]
automated match to d1pz9b_
complexed with ca, nag, po4
Details for d3v64b_
PDB Entry: 3v64 (more details), 2.85 Å
PDB Description: crystal structure of agrin and lrp4
PDB Compounds: (B:) Low-density lipoprotein receptor-related protein 4SCOPe Domain Sequences for d3v64b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v64b_ b.29.1.4 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
letlafdgrtyieylnavieseltneipaekalqsnhfelslrteatqglvlwigkaaer
adymalaivdghlqlsydlgsqpvvlrstvkvntnrwlrirahrehregslqvgneapvt
gssplgatqldtdgalwlgglqklpvgqalpkaygtgfvgclrdvvvghrqlhlledavt
kpelrpcptp
SCOPe Domain Coordinates for d3v64b_:
Click to download the PDB-style file with coordinates for d3v64b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3v64b_:
- d3v64b_ first appeared in SCOPe 2.02
- d3v64b_ appears in SCOPe 2.03
- d3v64b_ appears in SCOPe 2.05
- d3v64b_ appears in the current release, SCOPe 2.08
View in 3D
