Lineage for d3uyod_ (3uyo D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1767525Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1768056Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 1768057Protein automated matches [190976] (4 species)
    not a true protein
  7. 1768081Species Human (Homo sapiens) [TaxId:9606] [188649] (36 PDB entries)
  8. 1768089Domain d3uyod_: 3uyo D: [233822]
    Other proteins in same PDB: d3uyoa_
    automated match to d2ck2a_
    complexed with so4

Details for d3uyod_

PDB Entry: 3uyo (more details), 1.83 Å

PDB Description: Crystal structure of monobody SH13/ABL1 SH2 domain complex
PDB Compounds: (D:) Monobody SH13

SCOPe Domain Sequences for d3uyod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uyod_ b.1.2.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svssvptklevvaatptslliswdapavtvdfyvitygetggnspvqeftvpgskstati
sglspgvdytitvyagysdswnwpyspisinyrt

SCOPe Domain Coordinates for d3uyod_:

Click to download the PDB-style file with coordinates for d3uyod_.
(The format of our PDB-style files is described here.)

Timeline for d3uyod_: