Lineage for d3uwlb_ (3uwl B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972108Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2972109Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2972110Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2972567Protein automated matches [190469] (17 species)
    not a true protein
  7. 2972594Species Enterococcus faecalis [TaxId:1351] [194752] (5 PDB entries)
  8. 2972600Domain d3uwlb_: 3uwl B: [194753]
    automated match to d1tsla_
    complexed with edo, ffo, so4

Details for d3uwlb_

PDB Entry: 3uwl (more details), 2.07 Å

PDB Description: crystal structure of enteroccocus faecalis thymidylate synthase (efts) in complex with 5-formyl tetrahydrofolate
PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d3uwlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uwlb_ d.117.1.1 (B:) automated matches {Enterococcus faecalis [TaxId: 1351]}
meeaylalgkkileeghfkedrtgtgtyslfgyqmrfdlakgfpllttkrvpfgliksel
lwflkgdtniryllernnhiwdewaferyvksadyqgpdmtdfghrvlqdpafaeqykee
hqkfcdailndaefaekygelgniygaqwrhwetkdgsfidqlanviemiktnpdsrrli
vsawnpedvpsmalppchtmfqfyvnegklscqlyqrsadvflgvpfniasyallthlia
hetglevgefvhtlgdahlyqnhveqmqeqlsrevrsfptlvlnpdkasvfdfdmedikv
egydphptikapiav

SCOPe Domain Coordinates for d3uwlb_:

Click to download the PDB-style file with coordinates for d3uwlb_.
(The format of our PDB-style files is described here.)

Timeline for d3uwlb_: