Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (160 species) not a true protein |
Species Coxiella burnetii [TaxId:777] [226271] (1 PDB entry) |
Domain d3uwca_: 3uwc A: [217549] automated match to d2fnua_ complexed with dio, edo, na, pmp |
PDB Entry: 3uwc (more details), 1.8 Å
SCOPe Domain Sequences for d3uwca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uwca_ c.67.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]} mrvpysylerqfadiepylndlrefiktadftlgaelekfekrfaalhnaphaigvgtgt dalamsfkmlnigagdevitcantfiasvgaivqagatpvlvdsengyvidpekieaait dktkaimpvhytgniadmpalakiakkhnlhivedacqtilgrindkfvgswgqfacfsl hplknlnvwsdagviithsdeyaeklrlyrnhglinrdvcveygincrmdtiqavianrl mnqletitekrrgiahlydqsfvdlsefidvpvrregvyhvfhiyvlrvkyrdqlfqylk dngievkihypiamhlqpaakslgyqqgdfpmaekhgeavitlpahpylteeeinyiikk vrefylekhyn
Timeline for d3uwca_: