Lineage for d3uwca_ (3uwc A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2504652Species Coxiella burnetii [TaxId:777] [226271] (1 PDB entry)
  8. 2504653Domain d3uwca_: 3uwc A: [217549]
    automated match to d2fnua_
    complexed with dio, edo, na, pmp

Details for d3uwca_

PDB Entry: 3uwc (more details), 1.8 Å

PDB Description: structure of an aminotransferase (degt-dnrj-eryc1-strs family) from coxiella burnetii in complex with pmp
PDB Compounds: (A:) Nucleotide-sugar aminotransferase

SCOPe Domain Sequences for d3uwca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uwca_ c.67.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]}
mrvpysylerqfadiepylndlrefiktadftlgaelekfekrfaalhnaphaigvgtgt
dalamsfkmlnigagdevitcantfiasvgaivqagatpvlvdsengyvidpekieaait
dktkaimpvhytgniadmpalakiakkhnlhivedacqtilgrindkfvgswgqfacfsl
hplknlnvwsdagviithsdeyaeklrlyrnhglinrdvcveygincrmdtiqavianrl
mnqletitekrrgiahlydqsfvdlsefidvpvrregvyhvfhiyvlrvkyrdqlfqylk
dngievkihypiamhlqpaakslgyqqgdfpmaekhgeavitlpahpylteeeinyiikk
vrefylekhyn

SCOPe Domain Coordinates for d3uwca_:

Click to download the PDB-style file with coordinates for d3uwca_.
(The format of our PDB-style files is described here.)

Timeline for d3uwca_: