Lineage for d3ur8a_ (3ur8 A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.0: automated matches [191314] (1 protein)
not a true familyProtein automated matches [190075] (72 species)
not a true protein
Species Potato (Solanum tuberosum) [TaxId:4113] [193294] (4 PDB entries) 
Domain d3ur8a_: 3ur8 A: [195247]
automated match to d3em5a_
Details for d3ur8a_
PDB Entry: 3ur8 (more details), 1.26 Å
PDB Description: lower-density crystal structure of potato endo-1,3-beta-glucanase
PDB Compounds: (A:) Glucan endo-1,3-beta-D-glucosidaseSCOPe Domain Sequences for d3ur8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ur8a_ c.1.8.0 (A:) automated matches {Potato (Solanum tuberosum) [TaxId: 4113]}
qpigvcygkiannlpsdqdviklynannikkmriyyphtnvfnalkgsnieiildvpnqd
lealanpsnangwvqdnirnhfpdvkfkyiavgnevdpgresgkyarfvgpameniynal
ssaglqnqikvststysglltntypprdsifreeyksfinpiigflarhnlpllaniypy
fghidntnavplsyalfnqqrrndtgyqnlfdalvdsmyfateklggqnieiivsesgwp
seghpaatlknartyytnlinhvkrgagtpkkpgktietylfamfdenekkgeasekhfg
lfnpdqrpkyqlnfnlnhhhh
SCOPe Domain Coordinates for d3ur8a_:
Click to download the PDB-style file with coordinates for d3ur8a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ur8a_:
- d3ur8a_ first appeared in SCOPe 2.02
- d3ur8a_ appears in SCOPe 2.04
- d3ur8a_ is called d3ur8a1 in SCOPe 2.06
- d3ur8a_ appears in the current release, SCOPe 2.08, called d3ur8a1
View in 3D
