Lineage for d3unfy_ (3unf Y:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1936395Protein automated matches [190144] (7 species)
    not a true protein
  7. 1936958Species Mouse (Mus musculus) [TaxId:10090] [195917] (2 PDB entries)
  8. 1936974Domain d3unfy_: 3unf Y: [195932]
    Other proteins in same PDB: d3unfb_, d3unfc_, d3unfe_, d3unfg_, d3unfn_, d3unfp_, d3unfq_, d3unfs_, d3unfu_
    automated match to d1irul_
    complexed with 04c, cl, iod, k

Details for d3unfy_

PDB Entry: 3unf (more details), 2.9 Å

PDB Description: Mouse 20S immunoproteasome in complex with PR-957
PDB Compounds: (Y:) Proteasome subunit beta type-8

SCOPe Domain Sequences for d3unfy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3unfy_ d.153.1.4 (Y:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tttlafkfqhgvivavdsratagsyisslrmnkvieinpyllgtmsgcaadcqywerlla
kecrlyylrngerisvsaaskllsnmmlqyrgmglsmgsmicgwdkkgpglyyvddngtr
lsgqmfstgsgntyaygvmdsgyrqdlspeeaydlgrraiayathrdnysggvvnmyhmk
edgwvkvessdvsdllykyge

SCOPe Domain Coordinates for d3unfy_:

Click to download the PDB-style file with coordinates for d3unfy_.
(The format of our PDB-style files is described here.)

Timeline for d3unfy_: