Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (11 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [195917] (3 PDB entries) |
Domain d3unbz_: 3unb Z: [195920] Other proteins in same PDB: d3unbe_, d3unbg_, d3unbs_, d3unbu_ automated match to d1iru1_ complexed with 04c |
PDB Entry: 3unb (more details), 2.9 Å
SCOPe Domain Sequences for d3unbz_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3unbz_ d.153.1.4 (Z:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} rfspyafnggtvlaiagedfsivasdtrlsegfsihtrdspkcykltdktvigcsgfhgd cltltkiiearlkmykhsnnkamttgaiaamlstilysrrffpyyvyniiggldeegkga vysfdpvgsyqrdsfkaggsasamlqplldnqvgfknmqnvehvpltldramrlvkdvfi saaerdvytgdalricivtkegireetvplrkd
Timeline for d3unbz_:
View in 3D Domains from other chains: (mouse over for more information) d3unb1_, d3unb2_, d3unb3_, d3unb4_, d3unba_, d3unbb_, d3unbc_, d3unbd_, d3unbe_, d3unbf_, d3unbg_, d3unbh_, d3unbi_, d3unbj_, d3unbk_, d3unbl_, d3unbm_, d3unbn_, d3unbo_, d3unbp_, d3unbq_, d3unbr_, d3unbs_, d3unbt_, d3unbu_, d3unbv_, d3unbw_, d3unbx_, d3unby_ |