Lineage for d3ullb_ (3ull B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789342Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
    barrel, closed; n=5, S=10
  6. 2789438Protein ssDNA-binding protein [50264] (4 species)
  7. 2789466Species Human (Homo sapiens), mitochondria [TaxId:9606] [50265] (2 PDB entries)
    Uniprot Q04837
  8. 2789468Domain d3ullb_: 3ull B: [25283]
    has additional insertions and/or extensions that are not grouped together
    missing some secondary structures that made up less than one-third of the common domain

Details for d3ullb_

PDB Entry: 3ull (more details), 2.4 Å

PDB Description: human mitochondrial single-stranded dna binding protein
PDB Compounds: (B:) DNA binding protein

SCOPe Domain Sequences for d3ullb_:

Sequence, based on SEQRES records: (download)

>d3ullb_ b.40.4.3 (B:) ssDNA-binding protein {Human (Homo sapiens), mitochondria [TaxId: 9606]}
lerslnrvhllgrvgqdpvlrqvegknpvtifslatnemwrsgdsevyqlgdvsqkttwh
risvfrpglrdvayqyvkkgsriylegkidygeymdknnvrrqattiiadniifls

Sequence, based on observed residues (ATOM records): (download)

>d3ullb_ b.40.4.3 (B:) ssDNA-binding protein {Human (Homo sapiens), mitochondria [TaxId: 9606]}
lerslnrvhllgrvgqdpvlrqvegknpvtifslatnemwrskttwhrisvfrpglrdva
yqyvkkgsriylegkidygeymdknnvrrqattiiadniifls

SCOPe Domain Coordinates for d3ullb_:

Click to download the PDB-style file with coordinates for d3ullb_.
(The format of our PDB-style files is described here.)

Timeline for d3ullb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ulla_