Lineage for d3ulha_ (3ulh A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195051Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 2195506Protein automated matches [190332] (5 species)
    not a true protein
  7. 2195509Species Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries)
  8. 2195571Domain d3ulha_: 3ulh A: [250238]
    automated match to d1no8a_
    protein/RNA complex; complexed with po4

Details for d3ulha_

PDB Entry: 3ulh (more details), 2.54 Å

PDB Description: crystal structure of a rna binding domain of tho complex subunit 4 protein (thoc4) from homo sapiens at 2.54 a resolution
PDB Compounds: (A:) THO complex subunit 4

SCOPe Domain Sequences for d3ulha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ulha_ d.58.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agvetggkllvsnldfgvsdadiqelfaefgtlkkaavhydrsgrslgtadvhferkada
lkamkqyngvpldgrpmniqlvts

SCOPe Domain Coordinates for d3ulha_:

Click to download the PDB-style file with coordinates for d3ulha_.
(The format of our PDB-style files is described here.)

Timeline for d3ulha_: