Lineage for d3ul4a_ (3ul4 A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) 
Family b.2.2.0: automated matches [191610] (1 protein)
not a true familyProtein automated matches [191113] (13 species)
not a true protein
Species Clostridium thermocellum [TaxId:203119] [194259] (5 PDB entries) 
Domain d3ul4a_: 3ul4 A: [194260]
Other proteins in same PDB: d3ul4b_
automated match to d1aohb_
complexed with ca, peg, so4
Details for d3ul4a_
PDB Entry: 3ul4 (more details), 1.95 Å
PDB Description: Crystal structure of Coh-OlpA(Cthe_3080)-Doc918(Cthe_0918) complex: A novel type I Cohesin-Dockerin complex from Clostridium thermocellum ATTC 27405
PDB Compounds: (A:) Cellulosome-anchoring proteinSCOPe Domain Sequences for d3ul4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ul4a_ b.2.2.0 (A:) automated matches {Clostridium thermocellum [TaxId: 203119]}
ntieiiignvkarpgdrievpvslknvpdkgivssdfvieydsklfkvielkagdivenp
sesfsynvvekdeiiavlyleetglgieairtdgvfftivmevskdvkpgispikfesfg
atadndmnemtpklvegkveii
SCOPe Domain Coordinates for d3ul4a_:
Click to download the PDB-style file with coordinates for d3ul4a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ul4a_:
- d3ul4a_ first appeared in SCOPe 2.02
- d3ul4a_ appears in SCOPe 2.07
View in 3D
