Lineage for d3uidb_ (3uid B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668833Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1669085Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1669378Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 1669379Protein automated matches [190218] (19 species)
    not a true protein
  7. 1669491Species Mycobacterium smegmatis [TaxId:246196] [189822] (1 PDB entry)
  8. 1669493Domain d3uidb_: 3uid B: [186317]
    automated match to d1xfsa_

Details for d3uidb_

PDB Entry: 3uid (more details), 1.57 Å

PDB Description: crystal structure of protein ms6760 from mycobacterium smegmatis
PDB Compounds: (B:) Putative uncharacterized protein

SCOPe Domain Sequences for d3uidb_:

Sequence, based on SEQRES records: (download)

>d3uidb_ d.129.3.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
pvtdvkhdldtltltitaefaapvtriwqiyadprqlekvwgppshpatvvdhdlrpggr
vtyfmtgpdgekyagyweitavdephsfsfldgfadedfnpntdlpvstnvytftehdgg
tratyvgtyasaealqqvldmgviegassainqidalltath

Sequence, based on observed residues (ATOM records): (download)

>d3uidb_ d.129.3.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
pvtdvkhdldtltltitaefaapvtriwqiyadprqlekvwgppshpatvvdhdlrpggr
vtyfmtgpdgekyagyweitavdephsfsfldgfadedfnpvstnvytftehdggtraty
vgtyasaealqqvldmgviegassainqidalltath

SCOPe Domain Coordinates for d3uidb_:

Click to download the PDB-style file with coordinates for d3uidb_.
(The format of our PDB-style files is described here.)

Timeline for d3uidb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3uida_