Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
Protein automated matches [190218] (19 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [189822] (1 PDB entry) |
Domain d3uidb_: 3uid B: [186317] automated match to d1xfsa_ |
PDB Entry: 3uid (more details), 1.57 Å
SCOPe Domain Sequences for d3uidb_:
Sequence, based on SEQRES records: (download)
>d3uidb_ d.129.3.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]} pvtdvkhdldtltltitaefaapvtriwqiyadprqlekvwgppshpatvvdhdlrpggr vtyfmtgpdgekyagyweitavdephsfsfldgfadedfnpntdlpvstnvytftehdgg tratyvgtyasaealqqvldmgviegassainqidalltath
>d3uidb_ d.129.3.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]} pvtdvkhdldtltltitaefaapvtriwqiyadprqlekvwgppshpatvvdhdlrpggr vtyfmtgpdgekyagyweitavdephsfsfldgfadedfnpvstnvytftehdggtraty vgtyasaealqqvldmgviegassainqidalltath
Timeline for d3uidb_: