Lineage for d3uf2i_ (3uf2 I:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705548Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2705721Protein automated matches [190501] (4 species)
    not a true protein
  7. 2705722Species Human (Homo sapiens) [TaxId:9606] [187448] (21 PDB entries)
  8. 2705740Domain d3uf2i_: 3uf2 I: [193558]
    automated match to d1hmca_

Details for d3uf2i_

PDB Entry: 3uf2 (more details), 2.75 Å

PDB Description: Crystal structure of the human Colony-Stimulating Factor 1 (hCSF-1) cytokine
PDB Compounds: (I:) macrophage colony-stimulating factor 1

SCOPe Domain Sequences for d3uf2i_:

Sequence, based on SEQRES records: (download)

>d3uf2i_ a.26.1.2 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdime
dtmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllekvknvfn
etknlldkdwnifskncnnsfaecs

Sequence, based on observed residues (ATOM records): (download)

>d3uf2i_ a.26.1.2 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdime
dtmrfrdntpnaiaivqlqelslrlkscftkdkacvrtfyetplqllekvknvfnetknl
ldkdwnifskncnnsfaecs

SCOPe Domain Coordinates for d3uf2i_:

Click to download the PDB-style file with coordinates for d3uf2i_.
(The format of our PDB-style files is described here.)

Timeline for d3uf2i_: