Lineage for d3u7yl2 (3u7y L:102-210)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1520246Domain d3u7yl2: 3u7y L:102-210 [217219]
    automated match to d1z3gl2
    complexed with cl, flc, nag

Details for d3u7yl2

PDB Entry: 3u7y (more details), 2.45 Å

PDB Description: structure of nih45-46 fab in complex with gp120 of 93th057 hiv
PDB Compounds: (L:) NIH45-46 light chain, Ig kappa chain C region

SCOPe Domain Sequences for d3u7yl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u7yl2 b.1.1.0 (L:102-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ikrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvte
qdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d3u7yl2:

Click to download the PDB-style file with coordinates for d3u7yl2.
(The format of our PDB-style files is described here.)

Timeline for d3u7yl2:

1520246
d3u7yl2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3u7yl1