Lineage for d3u11b_ (3u11 B:)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
one turn of helix is made by two pairs of antiparallel strands linked with short turns
has appearance of a sandwich of distinct architecture and jelly-roll topology
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) 
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
Pfam PF00027
Protein automated matches [190352] (8 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [189505] (8 PDB entries) 
Domain d3u11b_: 3u11 B: [186054]
automated match to d1q5oa_
complexed with cmp, gol
Details for d3u11b_
PDB Entry: 3u11 (more details), 2.5 Å
PDB Description: Tetramerization dynamics of the C-terminus underlies isoform-specific cAMP-gating in HCN channels
PDB Compounds: (B:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4SCOPe Domain Sequences for d3u11b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u11b_ b.82.3.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgelseplree
iinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyfiqhgvv
svltkgnketkladgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr
rafetvaldrldrigkknsill
SCOPe Domain Coordinates for d3u11b_:
Click to download the PDB-style file with coordinates for d3u11b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3u11b_:
- d3u11b_ first appeared in SCOPe 2.01
- d3u11b_ appears in SCOPe 2.03
- d3u11b_ appears in SCOPe 2.05
- d3u11b_ appears in the current release, SCOPe 2.08
View in 3D
