Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
Protein automated matches [190352] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189505] (8 PDB entries) |
Domain d3u10a_: 3u10 A: [186052] automated match to d1q5oa_ complexed with cmp |
PDB Entry: 3u10 (more details), 2.3 Å
SCOPe Domain Sequences for d3u10a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u10a_ b.82.3.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree ivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv svltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr rafetvaidrldrigkknsill
Timeline for d3u10a_: