Lineage for d3tyia_ (3tyi A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily)
core: 3 helices; folded leaf, openedSuperfamily a.3.1: Cytochrome c [46626] (9 families) 
covalently-bound heme completes the coreFamily a.3.1.1: monodomain cytochrome c [46627] (16 proteins) 
Protein Mitochondrial cytochrome c [46642] (6 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (57 PDB entries)
Uniprot P00044
Domain d3tyia_: 3tyi A: [192162]
automated match to d2ycca_
complexed with hem, t3y
Details for d3tyia_
PDB Entry: 3tyi (more details), 1.4 Å
PDB Description: crystal structure of cytochrome c - p-sulfonatocalix[4]arene complexes
PDB Compounds: (A:) Cytochrome c iso-1SCOPe Domain Sequences for d3tyia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tyia_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
SCOPe Domain Coordinates for d3tyia_:
Click to download the PDB-style file with coordinates for d3tyia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3tyia_:
- d3tyia_ first appeared in SCOPe 2.02
- d3tyia_ appears in SCOPe 2.04
- d3tyia_ appears in SCOPe 2.06
- d3tyia_ appears in the current release, SCOPe 2.08
View in 3D
